Abstract
Background
The FabI enzyme, crucial for fatty acid synthesis, represents a promising target for antimalarial drug development, particularly in Plasmodium falciparum.
Aims
To comprehensively characterize the P. falciparum FabI enzyme by elucidating its evolutionary relationships, physicochemical properties, and detailed structural features using advanced in silico methodologies.
Methods
An extensive computational analysis was performed on 25 FabI protein sequences, encompassing those from P. falciparum as well as diverse protozoan and bacterial species.
Results
The predicted physicochemical properties indicated that P. falciparum FabI is comparatively larger, more hydrophilic, and exhibits a higher isoelectric point than its bacterial homologs. Sequence alignment and phylogenetic reconstruction revealed a clear evolutionary divergence of P. falciparum FabI from bacterial orthologs, supporting its origin through an ancient horizontal gene transfer event and its localization to the apicoplast. Further sequence analysis identified two conserved motifs mapped to a central NAD(P) binding Rossmann-fold domain, which is essential for the enzyme’s catalytic function. The predicted three-dimensional (3D) structure of P. falciparum FabI exhibited a characteristic α/β-fold architecture forming a dimeric complex. A persistent challenge was noted in the N-terminal region, predicted to be a flexible, cleavable signal/transit peptide, accounting for its lower structural confidence. PDBsum analysis delineated its structural organization, consisting of 19 α-helices and 9 β-strands, with a notable absence of disulfide bridges. Additionally, proteolytic digestion produced multiple cleavage patterns. CASTp 3.0 analysis revealed a complex active site comprising several sub-pockets and key functional residues, along with buried cavities.
Conclusion
These comprehensive structural and functional insights into the unique features of P. falciparum FabI provide a strong foundation for the rational design of novel antimalarial drugs.
Introduction
Malaria, a febrile disease, is caused by Plasmodium parasites transmitted to humans through the bites of infected female Anopheles mosquitoes (A. Pandey et al., 2022). The growing resistance of malaria parasites to first-line therapies highlights the urgent need to develop new classes of antimalarial agents (Kane et al., 2022). Consequently, the systematic identification and detailed characterization of unique parasite biochemical pathways have become essential, as these pathways provide promising targets for both novel drug discovery and the optimization of existing or emerging therapeutic strategies (A. K. Pandey et al., 2019).
These intracellular parasites depend on lipids for their growth, proliferation, and developmental progression. They utilize a prokaryotic-like Type II fatty acid synthesis (FAS-II) system housed within the apicoplast, an organelle crucial for the parasite’s blood-stage replication and overall pathogenicity (A. Pandey et al., 2022). Thus, the parasite’s fatty acid biosynthesis (FAS-II) pathway has emerged as a compelling therapeutic target due to its essential role in parasite viability (Kane et al., 2022). The distinct organization of the FAS-II pathway, when compared to the mammalian FAS-I complex, highlights its unique potential as a selective drug target.
FabI, the principal enoyl-ACP reductase within the FAS II system, is among the most extensively studied enzyme of this pathway. It is widely conserved across multiple microorganisms, including Staphylococcus aureus, Escherichia coli, Bacillus subtilis, Francisella tularensis, Burkholderia pseudomallei, Bacillus anthracis, Pseudomonas aeruginosa, as well as the protozoan parasites Toxoplasma gondii (Hopf et al., 2022), and Plasmodium falciparum (Kane et al., 2022). Given its pivotal role across a broad spectrum of pathogens, an in-depth understanding of FabI’s molecular and structural characteristics is of critical importance for guiding drug discovery efforts.
In recent years, in silico methodologies have become integral to modern drug discovery, offering powerful means to charaterize molecular targets and facilitate rational inhibitor design. These computational approaches allow precise delineation of a protein’s molecular properties, encompassing sequence architecture, physicochemical behavior, and evolutionary lineage, while identifting key functional elements such as conserved motifs, catalytic residues, and signal peptides. Such insights can be obtained prior to experimental validation or large-scale screening.
This study aimed to comprehensively characterize the P. falciparum FabI enzyme by elucidating its evolutionary relationships, physicochemical features, and intricate structural organization using advanced in silico techniques. The resulting findings establish a strong foundation for the rational design of selective FabI inhibitors, thereby contributing to the development of next-generation antimalarial therapeutics.
Materials and Methods
Sequence Retrieval and Alignment
Twenty-five enoyl-ACP reductase (FabI) sequences, representing both bacterial and eukaryotic (protozoan) origins, were retrieved from the UniProt (https://www.uniprot.org) (The UniProt Consortium, 2024). Sequence selection emphasized phylogenetic diversity and clinical relevance to human pathogenicity. Accession numbers for all sequences are listed in Supplementary Material (Table S1). Multiple sequence alignments were generated using the Clustal Omega algorithm (https://www.ebi.ac.uk/Tools/msa/clustalo/) (Madeira et al., 2024). The resulting alignments were visually examined and verified through manual inspection with the UniProt Alignment Viewer to ensure accurate alignment of conserved residues and the logical placement of gap regions.
Determination of Physicochemical Parameters
The physicochemical characteristics of FabI enzymes were computed from their amino acid sequences using the ExPASy ProtParam tool (http://web.expasy.org/protparam) (Gasteiger et al., 2005). The calculated parameters included molecular weight, isoelectric point (pI), extinction coefficient (EC), instability index (II), aliphatic index (AI), and grand average of hydropathicity (GRAVY).
Phylogenetic Tree Construction
A phylogenetic tree was constructed using the aligned amino acid sequences with the Simple Phylogeny tool available through EMBL-EBI (https://www.ebi.ac.uk/jdispatcher/phylogeny/simple_phylogeny) (Madeira et al., 2024). Evolutionary relationships among the taxa were inferred using the Neighbor-Joining algorithm, which operates on a pairwise distance matrix derived from the multiple sequence alignment.
Primary Structure Analysis
Primary structure analysis was conducted using the ExPASy ProtParam tool, specifically to determine the amino acid composition. Conserved protein motifs were identified with the MEME suite (http://meme.sdsc.edu/meme/meme.html) (Bailey & Elkan, 1994). Protein domains were examined using InterProScan (http://www.ebi.ac.uk/interpro/search/sequence/) (Blum et al., 2024).
Secondary Structure Analysis
The secondary structural content of the FabI sequences, including alpha helices, beta turns, extended strands, and random coils, was predicted using the SOPMA method available through the Network Protein Sequence Analysis (NPS@) server (https://npsa-prabi.ibcp.fr/cgibin/npsa_automat.pl?page=npsa_sopma.html) (Geourjon & Deléage, 1995).
Tertiary structure prediction for P. falciparum FabI was generated using ColabFold, an optimized AlphaFold2 implementation created for accelerated protein structure prediction. ColabFold was assessed through the COSMIC platform (https://cosmic-cryoem.org/tools/colabfold/) (Mirdita et al., 2021), and the resulting three-dimensional (3D) structural model was subsequently visualized using PyMOL.
The predicted 3D structure was further interpreted through the PDBsum tool (https://www.ebi.ac.uk/thornton-srv/databases/cgibin/pdbsum/GetPage.pl?pdbcode=index.html), which provided a secondary motif map and topology diagram. Predicted disulfide bridge patterns were evaluated using the CYS-REC tool (http://softberry.com/berry.phtml), allowing the identification of probable disulfide bonding between available Cysteine (Cys) residues.
Tertiary Structure Validation
The P. falciparum FabI model underwent extensive validation using multiple computational approaches. QMEAN (https://swissmodel.expasy.org/qmean) was employed to assess both global and local model quality (Benkert et al., 2010; Studer et al., 2014, 2019). Additional validation was performed through the SAVES server (https://servicesn.mbi.ucla.edu/SAVES) (Colovos & Yeates, 1993; Laskowski et al., 1996), which produced a Ramachandran plot using PROCHECK, and evaluated structural error rates using ERRAT. The Ramachandran plot served as the primary stereochemical quality indicator, while ERRAT confirmed crystallographic model accuracy. Predicted salt bridges were also analyzed using dedicated protein analysis tools.
Functional Analysis
Proteolytic cleavage sites, including those produced by chemical reagents, were predicted using PeptideCutter (http://web.expasy.org/peptide_cutter/) (Gasteiger et al., 2005). Signal peptide regions were prediction with SignalP 6.0 (https://services.healthtech.dtu.dk/services/SignalP-6.0/) (Teufel et al., 2022), which detects all five known signal peptide types (Sec/SPI, Sec/SPII, Tat/SPI, Tat/SPII, Sec/SPIII). The Computed Atlas of Surface Topography of proteins (CASTp 3.0) server (http://sts.bioe.uic.edu/) was used to identify active binding site pockets and to analyze the protein surface topography (Tian et al., 2018).
Results
Sequence Retrieval and Alignment
The protein sequences of FabI enzymes from a range of bacterial strains and protozoa were retrieved from UniProt, with FASTA format sequences selected and prioritized based on pathogens relevant to human health, as indicated in UniProt (Table S1).
Homology searching followed by multiple sequence alignment of the 25 FabI enzyme sequences revealed several regions of high conservation. The alignment displayed two particularly well conserved motifs, AKAALES (326–332), and RVNAISAGPIRT (348–359) (Figure 1). In addition to these conserved stretches, a set of 16 amino acid positions demonstrated 100% conservation across all sequences examined. These residues included Glycine (Gly) 128, Aspartic acid (Asp) 206, Histidine (His) 252, Serine (Ser) 282, Ser 285, Tyrosine (Tyr) 309, Tyr319,
Methionine 323, Alanine (Ala) 338, Gly434, Leucine (Leu) 440, Ser 442, Gly450, Valine 455, Asp456, and Gly458. Collectively, these fully conserved residues represented a braod spectrum of amino acid classes, including: nonpolar (Ala, Leu, Gly, Methionine, Valine), polar (Ser), aromatic (Tyr), acidic (Asp), and basic (His).
Phylogenetic Analysis of FabI Enzyme Sequences
The unrooted phylogenetic tree (Figure 2), constructed from FabI enzyme protein sequences, depicts the evolutionary relationships among the sampled bacterial and protozoan taxa. Plasmodium (evolutionary distance: 0.31445) is positioned within a distinct and well-supported clade of Apicomplexa parasites, clustering with Neospora (0.05476), Toxoplasma (0.06203), Cyclospora (0.10345), and Eimeria (0.11790). These taxa form a compact clade with short internal branch lengths, suggesting a recent common evolutionaty origin among these protozoan parasites. The entire Plasmodium-containing clade remains clearly separated from all bacterial taxa represented in the tree, indicating substantial evolutionary divergence.
Physicochemical Properties of FabI Enzymes
Analysis of physicochemical properties demonstrated both shared features and distinct differences across FabI enzymes from protozoa and bacteria (Table 1). FabI enzymes from protozoan parasites were generally longer (393–432 amino acids), and possessed higher molecular weights (approximately 40–49 kDa), whereas bacterial FabI proteins were typically shorter (250–275 amino acids) with lower molecular weights (26–30 kDa).
Isoelectric point (pI) values also displayed a clear taxonomic distinction protozoan FabI enzymes displayed higher pIs (6.01–9.11), with P. falciparum displaying the highest pI at 9.11, while most bacterial FabI enzymes had lower pI values (5.15–5.77). Notably, Helicobacter pylori (pI 7.1) and Rickettsia conorii (pI 7.71) were exceptions to this trend.
The AI indicated that a tendency toward greater aliphatic content among bacterial FabI proteins (85.92–105.72) compared to protozoan FabI (77.92–91.46), with Enterococcus faecalis demonstrating the highest value. GRAVY values similarly highlighted these differences: protozoan FabI enzymes displayed more hydrophilic properties (negative GRAVY values from 0.046 to −0.683), with P. falciparum being the most hydrophilic, whereas bacterial FabI enzymes were slightly hydrophobic (positive GRAVY values from 0.012 to 0.191). Instability indices for most FabI proteins were below 40, indicating overall structural stability, although P. falciparum showed a slightly higher instability value (45.92).
Protozoan FabI enzymes also contained larger numbers of both acidic (R- values from 35–47) and basic (R+ values from 35–57) residues compared to their bacterial FabI sequences, which typically contained fewer acidic (25–33) and basic (21–28) residues. In accordance with this trend, ECs were higher for protozoan enzymes (27390–48360) than for bacterial ones (13075–21680), aside from H. pylori and R. conorii, which again showed higher values than typical bacterial species.
Primary Sequence Analysis
The primary structure analysis, represented by the amino acid composition chart (Figure 3), highlights the relative abundance of amino acids within the FabI enzyme. Ala, is the most prevalent amino acid, comprising 16% of the total sequence, followed by Leu at 13.1%, Asparagine at 12.7%, Gly at 12.1%, and Ser at 10.6 (Figure 3). In contrast, several amino acids occur at very low frequencies. Tryptophan is the least abundant, accounting for only 1.2%, followed by Cys at 1.9% and His at 2.9%. The low proportion of Cys is particularly notable and suggests a minimal role in disulfide bond formation or catalytic stabilization within the overall protein structure.
A motif analysis of 25 FabI protein sequences (Figure 4) revaeled that Motif 2 (FRKMLAHCEAVTPJRRTVTI-EDVGNSAAFLCSDLSAGISGEVLHVDGGFS) and Motif 3 (FLTGKRILVTGVASKLSIAYGIAQAMHREGAELAF-TYQNEK) were present across all 25 sequences. By contrast, Motif 1 (YLGAERAIPNYNVMG-LAKASLEANVRYMANAMGPEGVRVNAISAGPIRTL) was found exclusively in bacterial sequences, with complete absence in the five parasitic FabI sequences. Additionally, although motif architecture in bacterial sequences showed highly consistent spatial arrangement and spacing, parasitic sequences demonstrated variability in motif positioning.
InterPro analysis of Motif 1, Motif 2, and Motif 3 further confirmed that all three motifs map to a single conserved functional domain, corresponding to the NAD(P) binding Rossmann-fold domain.
Secondary Structure Composition of FabI Enzymes
Analysis of predicted secondary structure composition for FabI enzymes across bacterial and protozoan taxa revealed conserved structural features along with notable taxonomic differences (Table 2). Alpha helices represented the predominant secondary structural element in all FabI enzymes, consistently accounting for more than 42% of the sequences, with P. falciparum displaying the highest value at 49.77%.
In contrast, protozoan FabI enzymes exhibited lower proportions of extended strands (9.92%–14.39%) and beta turns (5.12%–6.94%) compared with bacterial sequences, which typically contained extended strands ranging from 15.65% to 19.38%, and beta turns between 7.31% and 9.16%. Correspondingly, FabI proteins from Cyclospora cayetanensis, Eimeria tenella, Neospora caninum, and T. gondii contained notably higher proportions of random coils (35.49%–38.42%) than most bacterial FabI enzymes (25%–31%), with P. falciparum serving as an exception among protozoa at 30.56%.
Significantly, the prediction for disulfide bridges was “none” across all FabI sequneces analyzed, indicating a consistent absence of disulphide-bond stabilization within the predicted structures.
Further structural interpretation via PDBsum, generated using the predicted P. falciparum FabI structure as a reference model (Figure 5), revealed a mixed alpha/beta fold typical of metabolic enzymes.
The FabI structure is predominantly helical, comprising 19 alpha helices (H1–H19) (Figure 6), distributed throughout the polypeptide chain, along with 9 beta-strands forming multiple beta sheets that contribute to the protein’s core stability. These regular secondary structure elements are interconnected via loops and turns, forming the characteristic topological arrangement depicted in the PDBsum analysis.
Tertiary Structure Analysis
The stereochemical quality of the predicted FabI enzyme structure was assessed using a Ramachandran plot generated by PROCHECK (Figure 7). The results demonstrated that the majority of amino acid residues occupy energetically favorable conformational regions. Specifically, 71.5% (1144 residues) were located in the most favored regions, while 21.8% (349 residues) fell within additionally allowed regions. A further 6.4% (103 residues) were present in generously allowed regions. Only 4 residues (0.2%) appeared in disallowed regions. Given that 1600 non-Gly and non-Proline (Pro) residues were evaluated (with Gly and Pro excluded due to their atypical conformational flexibility, this extremely low percentage of disallowed residues indicates high stereochemical quality and provides strong confidence in the predicted FabI model.
ERRAT analysis was subsequently performed to evaluate overall and local model quality (Figure 8). The predicted structure achieved an Overall Quality Factor of 78.71%. The ERRAT output highlights several regions with elevated error values, indicated by prominent red peaks. These occur primarily within the residue ranges 20–40 and 120–130, where error values approach the 95% rejection limit.
Local model reliability was further assessed through the Local Quality Estimate plot (Figure 9), which provides confidence values on a per-residue basis. For most of the structure (approximately residue 75 onward), the predicted confidence remains consistently above 0.7, indicating high accuracy in these regions.
In contrast, the N-terminal segment (residues 0–75) displays substantially lower confidence, with scores frequently dropping below 0.5 and, in several positions, approaching 0.1. Additionally but comparatively minor dips in confidence occur near residue 330 and toward the C-terminus region beyond residue 380.
Functional Analysis
Signal Peptide Prediction
The N-terminal sequence of the FabI enzyme was examined using SignalP 6.0 to determine the presence and likely location of a signal peptide (Figure 10). The prediction profile displays a prominent n-region (Sec/SPI n, solid red line) at the extreme N-terminus, corresponding to a positively charged stretch. This is followed by a strong hydrophobic h-region (Sec/SPI h, orange line), which extends from approximately residue 3 to residue 15, and peaks near residue 10.
Subsequently, the c-region (Sec/SPI c, yellow line) reaches its maximum probability around residue 24, indicating the most likely cleavage site. After residue 25, the probability for “OTHER” (non-signal peptide regions, dashed red line) increases sharply, marking the transition into the mature protein. Collectively, these predicted profiles indicate a canonical Sec/SPI signal peptide at the N-terminal region, with the cleavage site estimated between residues 22 and 25.
In Silico Proteolytic Digestion
An in silico proteolytic digestion analysis was carried out to predict potential cleavage sites and fragment numbers across the FabI enzyme using multiple proteases and chemical reagents (Table 3). The number of predicted cleavage events varied widely, ranging from a single cut to as many as 194, depending on protease specificity.
Proteinase K showed the highest cleavage frequency, with 194 predicted sites, followed by Thermolysin (120 cleavage sites), Pepsin at pH > 2 (98 cleavage sites), and Chymotrypsin (low-specificity) (94 cleavage sites), all of which would generate numerous small peptide fragments.
In contrast, enzymes with narrow specificity, such as Caspase1 and Pro endopeptidase, produced only a single predicted cleavage event. Similarly, BNPS-Skatole and Iodosobenzoic acid each generated two cuts, while Hydroxylamine and NTCB produced three cuts. Enzymes with moderate specificity, such as Trypsin (54 cleavages) and high specificity-Chymotrypsin (40 cleavages), yielded intermediate fragmentation patterns.
Characterization of Active Site and Other Pockets via CASTp 3.0
The CASTp 3.0 server was used to perform a detailed topological analysis of the P. falciparum FabI protein, with particular emphasis on the characterization of active site pockets. The most prominent active site was represented by four discrete pocket instances, exhibiting solvent-accessible surface areas of 8.368 Ų, 8.360 Ų, 8.375 Ų, and 8.147 Ų, with corresponding volumes of 43.996 ų, 43.763 ų, 43.429 ų, and 43.133 ų, respectively. Functionally important residues identified within these pockets included Tyr267, His268, Ser311, Ala312, Gly313, and Pro314, Ala372, Tyr375, and Asp414.
In addition to these active site pockets, CASTp analysis revealed another large and centrally located pocket with a substantially greater surface area (951.472 Ų) and volume (851.864 ų). Key residues lining this central cavity included His268, Ser270, and Glutamine 271 (Gln271), together with Threonine 292 (Thr292), Arginine 293 (Arg293), Tyr412, and Isoleucine 419 (Ile419). The 3D representation of these identified pockets is shown in (Figure 11), where the four active site-associated pockets are highlighted in pink and the centrally located pocket is depicted in black.
Discussion
Two highly conserved regions, AKAALES and RVNAISAGPIRT, were identified within FabI enzyme sequences, underscoring their likely functional importance. Although conservation is broadly maintained, several amino acid positions exhibit specific substitutions. Some substitutions retain similar physicochemical properties (conservative), while others introduce marked changes (non-conservative).
In the AKAALES region, Ala329 occasionally undergoes a non-conservative substitution to Ser, thereby introducing a polar hydroxyl group in place of the nonpolar methyl group typically resides there. Conversely, Glutamic Acid 331 shows a highly conservative change to Asp since both are acidic, negatively charged amino acids, which ensures that the electrostatic role of the site is preserved. At the position 332, a notable degree of variation is observed, directly influencing the local polarity. The substitution from Ser to Ala is non-conservative because it shifts the residue’s characteristic from polar to nonpolar. Furthermore, in one instance, Thr (T) is present at this site. When considering this change, a substitution from Ser to Thr is conservative, as both are polar amino acids possessing similar hydroxyl groups; however, if Ala were replaced by Thr, it would constitute a non-conservative change.
Within the longer RVNAISAGPIRT region, variations at position 349 (Valine to Ile), and at position 352 (Ile to Valine or Leu) are conservative, since all involved amino acids are nonpolar, branched-chain hydrophobics and collectively maintain the local hydrophobic environment. Similarly, the alternations at positions 357 (Leu/Ile), 358 (Lysine/Arg), 359 (Ser/Thr), are also conservative. However, at position 351 (typically Ala) in RVNAISAGPIRT there are diverse non-conservative substitutions to Gly, Ser, Thr, or Cys. These changes can either alter local flexibility (Gly) or significantly modify the polarity (Ser, Thr, Cys). The Cys substitution is particularly notable because its reactive thiol group could introduce new chemical functionalities. Lastly, the change from Pro to Ala at position 356 is non-conservative, as this substitution, observed in only one instance, fundamentally alters the local structural rigidity. Altogether, these patterns highlight a strategic balance, in which conservative substitutions maintain core function through preservation of essential physicochemical properties, while non-conservative changes may reflect specific evolutionary adaptations that influence enzyme characteristics and could impact activity, substrate specificity, or stability in different host environments.
The phylogenetic analysis of FabI enzyme sequences yields crucial insights into their evolutionary origins and relationships across diverse taxa. A key finding is the clear and substantial evolutionary distance observed between the Plasmodium-containing Apicomplexa clade and all bacterial lineages represented in the tree. This distinct separation, in which Plasmodium’s FabI clusters tightly with other apicomplexan orthologs yet remains phylogenetically distant from all bacterial FabI sequences, is highly significant because FabI is fundamentally a prokaryotic (bacterial) FAS enzyme. The presence of such a typically bacterial enzyme within a eukaryotic parasite like Plasmodium, as evidenced by its unique branching pattern in the tree, strongly supports its acquisition through an ancient horizontal gene transfer (HGT) event. This transferred gene likely originated from a bacterial ancestor that became endosymbiotic and ultimately gave rise to the apicoplast-a non-photosynthetic plastid within Apicomplexa that houses the bacterial-derived FAS-II pathway. This profound evolutionary divergence of apicomplexan FabI from extant bacterial enzymes together with its distinctness from human FAS pathways, positions it as a highly promising target for anti-parasitic drug development.
The observed distinct physicochemical profiles between protozoan and bacterial FabI enzymes offer valuable insights into their functional adaptations and evolutionary trajectories. The larger size and higher molecular weight of FabI from protozoan parasites, together with their generally higher isoelectric points (pI) and greater hydrophilicity (negative GRAVY values), stand in sharp contrast to the smaller, more hydrophobic, and typically lower pI bacterial FabI. This comparison suggests that protozoan FabI enzymes, such as those in Plasmodium with its notably high pI and hydrophilicity, may be specifically adapted for different intracellular environments or protein interaction partners than their bacterial counterparts. For instance, increased hydrophilicity could indicate greater surface exposure or more extensive interactions with the aqueous lumen of the apicoplast, where these enzymes function.
Furthermore, the higher count of charged residues (acidic and basic) in protozoan FabI contributes to their distinct pI values and to potentially more complex electrostatic interactions. While most bacterial FabI display consistent characteristics, the exceptions, such as the higher pI observed in H. pylori and R. conorii, might reflect adaptations to unique intracellular or extracellular niches and corroborate the distinct branching patterns observed in the phylogenetic analysis.
A motif analysis was performed on 25 FabI protein sequences. Notably, despite the overall conservation of Motif 2 and Motif 3, several parasitic FabI sequences showed shifts in the relative positions of these motifs compared to their bacterial counterparts. Such positional shifts may reflect structural adaptations or domain rearrangements specific to the parasite’s cellular environment or evolutionary history. The absence of Motif 1 in protozoan FabI sequences, despite its broad and consistent presence in bacteria, further suggests a significant evolutionary divergence. This indicates that protozoan FabI either performs its function using a different molecular mechanism that does not require Motif 2, or that this region was lost or became highly divergent following the initial HGT event from a bacterial ancestor.
The precise mapping of all three identified conserved motifs to a specific domain within P. falciparum FabI provides critical insights into its functional architecture, and this domain’s identification as a NAD(P) binding Rossmann-fold domain is highly significant.
The Rossmann fold is a well-established supersecondary structural motif that is essential for binding nucleotides, particularly NAD(P)H, which serves as a vital cofactor for a vast array of oxidoreductases. Given that FabI (enoyl-ACP reductase) is an oxidoreductase that absolutely requires NAD(P)H for its catalytic activity, locating these three conserved motifs precisely within this NAD(P) binding Rossmann-fold domain directly confirms the structural basis for cofactor recognition and enzymatic function. Their presence within this specialized domain also strongly suggests direct involvement in substrate binding, catalysis, or cofactor interaction.
The predicted secondary structure profiles additionally highlight lineage-specific adaptations of FabI enzymes. The predominance of alpha-helical content across all analyzed FabI sequences points to a shared compact globular architecture that is essential for enzymatic function. However, compared to their bacterial counterparts, protozoan FabI enzymes generally contain lower proportions of extended strands and beta turns while exhibiting higher random coil content, indicating a potentially greater inherent flexibility. Notably, P. falciparum is distinct among protozoa, with a random coil percentage more closely aligned with bacterial FabI, suggesting a particular structural adaptation possibly tied to unique functional requirements or its intracellular environment. Most significantly, the universal absence of predicted disulfide bridges across all FabI enzymes strongly indicates that these proteins operate in reducing cellular environments, such as the bacterial cytoplasm or the apicoplast lumen, where stabilizing bonds are not typically formed.
The ERRAT analysis provided a important assessment of the predicted FabI enzyme structure. Although the overall quality factor suggests a plausible structural model, the most prominent areas of concern are highly localized within the N-terminal region, particularly around residues 20–40. This clustering of high error values (red spikes) is strongly suggestive of a cleavable N-terminal signal or transit peptide. Because P. falciparum FabI is known to be targeted to the apicoplast, such targeting sequences are inherently flexible or unstructured in the mature protein and are normally cleaved off following import into the organelle. As a result, computational modeling tools frequently struggle to accurately predict the conformation of these dynamic or absent regions, leading to their erroneous classification by quality assessment programs like ERRAT. For this reason, the localized discrepancy does not invalidate the accuracy of the predicted 3D structure of the mature, functional FabI enzyme.
The Local Quality Estimate plot provides a crucial residue-level assessment of the predicted FabI enzyme structure and offers insights into the reliability of different regions. Across the majority of the protein, the confidence scores remain generally high (typically above 0.7 from residue ~75 onwards), which is encouraging and suggest that the previously described core structural elements and overall fold are well-predicted and represent a reliable model for the mature, functional enzyme.
In contrast, the N-terminal segment (residues 0 to ~75) displays a prominent and consistent region of significantly low confidence, and this pattern constitues a key observationthat warrants specific discussion. The same region has been highlighted in the ERRAT plot through high error values, and the agreement between between both analyses strongly supports the interpretation that this segment reprsents an intrinsically disordered or highly flexible N-terminal signal/transit peptide.
This conclusion is further supported by SignalP 6.0, which predicts a cleavable signal peptide with a likley cleavage site near residues 22–25, consistent withprevious indicators that the N-terminus remains unstructured before processing.
The in silico proteolytic digestion analysis also provides a useful guidance for future biochemical characterization of P. falciparum FabI. The wide range in predicted cleavage events, from a single cut to almost 200, reflects the diverse specificities of the proteases and chemical reagents tested.
Broad specificity enzymes such as Proteinase K, Thermolysin, Pepsin, and low-specificity Chymotrypsin are effective for extensive digestion, which may be useful for amino acid composition analysis or generating small peptides for mass spectrometry identification.
Conversely, proteases like Caspase1 and Pro-endopeptidase, which each yield only one cleavage site, are highly selective and therefore valuable for isolating large, well-defined fragments for structural studies or targeted protein engineering. Limited cleavage by chemical reagents such as BNPS-Skatole and Hydroxylamine similarly confirms their utility for generating a few large peptides by acting on less common amino acid residues. Together, this cleavage map forma an important foundation for experimental design, including peptide fingerprinting, structural domain isolation, and verifying recombinant protein integrity.
The CASTp 3.0 analysis further contributes by characterizing the surface features and internal topography of the FabI enzyme.
The prominent active site appears as four relatively small pocket instances (each with areas of 8 Ų and volumes of 43 ų), suggesting a more complex architecture than a single cavity. These multiple sub-pockets may accommodate different substrate regions or catalytic intermediates involved in multi-step FAS. The central cavity could also function as an allosteric binding site, a channel for substrate/product passage, or a location involved in conformational shifts. Altogether, these detailed topographical insights are invaluable for understanding catalytic mechanism, predicting ligand binding, and guiding inhibitor design.
Conclusion
This comprehensive computational structural and functional study has meticulously characterized the P. falciparum FabI enzyme, which serves as a critical antimalarial target. The work provides a robust foundation for researchers to gain a detailed understanding of its protein structure, thereby facilitating the rational design of novel compounds with desirable characteristics for exploiting them as potential drug targets against malaria. However, further experimental (in vitro and in vivo) studies are essential to validate these computational predictions.


